PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1654150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 175aa    MW: 19447.6 Da    PI: 5.3814
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1654150.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.93e-5327121296
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdr+ Pianv+rimk++lP+nakisk+aket+qecvsef+sfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy++plk yl+kyrel+g
  Lj5g3v1654150.1  27 REQDRLRPIANVGRIMKQILPSNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTVNGDDVCWALGTLGFDDYADPLKRYLNKYRELDG 120
                      89*****************************************************************************************998 PP

            NF-YB  96 e 96 
                       
  Lj5g3v1654150.1 121 G 121
                      5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.4E-5024136IPR009072Histone-fold
SuperFamilySSF471132.58E-3829135IPR009072Histone-fold
PfamPF008083.9E-263496IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.5E-196078No hitNo description
PRINTSPR006154.5E-197997No hitNo description
PRINTSPR006154.5E-1998116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGEREAAFNI NYNFSDNTAE EDGIIIREQD RLRPIANVGR IMKQILPSNA KISKEAKETM  60
QECVSEFVSF VTGEASDKCH KEKRKTVNGD DVCWALGTLG FDDYADPLKR YLNKYRELDG  120
GRANQNKGNN SGDENNIEGY HNCEGKPPPA PGSSSNPVAM LKLNDRSSVP QSRGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4326117192Transcription factor HapC (Eurofung)
4g91_B2e-4326117192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373580.0BT137358.1 Lotus japonicus clone JCVI-FLLj-13H4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518964.15e-70PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822488e-59NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLI3SA611e-127I3SA61_LOTJA; Uncharacterized protein
STRINGGLYMA02G17310.12e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-60nuclear factor Y, subunit B5